Patched 1 antibody

Catalog No. ABIN634927

This Rabbit Polyclonal antibody specifically detects Patched 1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Patched 1 antibody (ABIN634927)

Target: Patched 1 (PTCH1)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Patched 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Patched 1 Antibody

Purification: Affinity purified

Immunogen: PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTCH1 Blocking Peptide, (ABIN5615646), is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Patched 1

Target: Patched 1 (PTCH1)

Alternative Name: PTCH1

Background: PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Hedgehog Signaling, Carbohydrate Homeostasis, Tube Formation